PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_02269.1_g00003.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family MYB
Protein Properties Length: 299aa    MW: 31750.2 Da    PI: 6.7251
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_02269.1_g00003.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding28.14.8e-091256345
                             SS-HHHHHHHHHHHHHTTTT...-HHHHHHHHTTTS-HHHHHHHHH CS
          Myb_DNA-binding  3 rWTteEdellvdavkqlGgg...tWktIartmgkgRtlkqcksrwq 45
                             +W+ e+d  + +a + +  +    W++Ia+ ++ g++  q+k+++ 
  Rsa1.0_02269.1_g00003.1 12 AWSREDDIAFERALASYTDEseeKWEKIAADVP-GKSVQQIKEHYE 56
                             7*****************99*************.**********95 PP

2Myb_DNA-binding40.56.2e-13120164347
                              SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
          Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                              +W+++E+ l++ +  ++G+g+W++I+r +  +Rt+ q+ s+ qky
  Rsa1.0_02269.1_g00003.1 120 AWSEDEHRLFLLGLDKYGKGDWRSISRNFVVTRTPTQVASHAQKY 164
                              6*******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM007171.5E-8961IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.9E-51156IPR009057Homeodomain-like
PROSITE profilePS500906.7951159IPR017877Myb-like domain
CDDcd001672.00E-81259No hitNo description
PfamPF002499.3E-81256IPR001005SANT/Myb domain
SuperFamilySSF466895.46E-101366IPR009057Homeodomain-like
PROSITE profilePS5129417.139112169IPR017930Myb domain
SuperFamilySSF466895.02E-16115170IPR009057Homeodomain-like
TIGRFAMsTIGR015579.3E-17117167IPR006447Myb domain, plants
SMARTSM007176.6E-10117167IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.3E-10120163IPR009057Homeodomain-like
PfamPF002496.1E-11120164IPR001005SANT/Myb domain
CDDcd001671.83E-9120165No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 299 aa     Download sequence    Send to blast
MTVEEVSGDG SAWSREDDIA FERALASYTD ESEEKWEKIA ADVPGKSVQQ IKEHYELLVE  60
DVSRIESGCV PLPSYRGYPL EDAGGCDDGG GGSSKKGGGN NSHDQGSKAK ADQERRKGIA  120
WSEDEHRLFL LGLDKYGKGD WRSISRNFVV TRTPTQVASH AQKYFIRLNS MNKDRRRSSI  180
HDITSVGDAD VSTPQGPITG QNNNTTTGSA PVAGGGNKSV KQAASQPPPG PPMYGTPTVG  240
QPVGGPLVSA VGTPVNLPAP PHMAYGVHAA SVPGSVVPGA PMNMAQMPYT MPRTPTAHR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2cjj_A4e-17876674RADIALIS
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00500DAPTransfer from AT5G08520Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3529811e-113AK352981.1 Thellungiella halophila mRNA, complete cds, clone: RTFL01-15-N01.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006399351.10.0hypothetical protein EUTSA_v10014203mg
RefseqXP_009122461.10.0PREDICTED: transcription factor DIVARICATA
SwissprotQ8S9H73e-58DIV_ANTMA; Transcription factor DIVARICATA
TrEMBLA0A078C1780.0A0A078C178_BRANA; BnaA10g22930D protein
TrEMBLE4MWT40.0E4MWT4_EUTHA; mRNA, clone: RTFL01-15-N01
TrEMBLM4CYP90.0M4CYP9_BRARP; Uncharacterized protein
TrEMBLV4LAV40.0V4LAV4_EUTSA; Uncharacterized protein
STRINGBra009346.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM35562861
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G08520.11e-149MYB family protein